PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29728.m000844
Common NameLOC8262744, RCOM_0686950
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family GRAS
Protein Properties Length: 471aa    MW: 53631 Da    PI: 6.5815
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29728.m000844genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS2991.2e-91824691374
           GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshl 96 
                    l++lLl  A+av++++ + a + L++l + +  +gd++qR++ayf+ +L+arl+   s  y+ +  ++ts    +ee+ a++ ++ vsP+++f+h+
  29728.m000844  82 LIHLLLITATAVDENNVATALENLSELYTSVCLTGDSVQRVVAYFADGLSARLLTRKSPFYEMIMKEPTS----EEEFLAFTHLYRVSPYYQFAHF 173
                    689****************************************************999999988877775....788899999************* PP

           GRAS  97 taNqaIleavege.........ervHiiDfdisqGlQWpaLlqaLasRp..egppslRiTgvgspesgskeeleetgerLakfAeel.gvpfefnv 180
                    taNqaIlea+e+e         + +H+iDfd+s+G+QWp+L+q+L++++  ++  slRiTg+g+    s eel+et++rL +fA+ + ++ f+f+ 
  29728.m000844 174 TANQAILEAFEKEeeeesdsksRILHVIDFDVSYGFQWPSLIQSLSEKAssSNRISLRITGLGR----SLEELQETESRLVSFAKGFrNLVFDFQG 265
                    ***********99888888774456***********************95444559********....9****************9758******* PP

           GRAS 181 lvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklp 276
                    l  +  + ++  ++  k++E++aVnlv +l +l  + +++++    +Lk + sl+P +v++veqe +++  sFl rf+e+l+y++a++dsl+  lp
  29728.m000844 266 L-LRGSKIISNPRI-RKKNETVAVNLVSHLNTLN-DFLKIPD----TLKSIHSLNPSIVILVEQEGSRSPRSFLSRFMESLHYFAAMYDSLDDCLP 354
                    6.666777766666.3569**********99996.7777777....************************************************** PP

           GRAS 277 reseerikvErellgreivnvvacegae..rrerhetlekWrerleeaGFkpvplsekaakqaklllr..kvk.sdgyrveee...........sg 356
                     es+er ++E+  lg+ei++++   +++     r e++e+W+ r+e+ GF+ ++ls+k   qaklll+  +++    ++ e++           +g
  29728.m000844 355 LESSERLSIEKNHLGKEIKSMLNYDKDDlnCATRYEKMETWKGRMENHGFSGMKLSSKSLIQAKLLLKirTHHsPPQFNGENSsgsgfrvferdEG 450
                    ***********************9999865789*********************************973322222224444222233333333455 PP

           GRAS 357 slv.lgWkdrpLvsvSaWr 374
                      + lgW+dr L+++SaWr
  29728.m000844 451 KTIsLGWQDRCLLTASAWR 469
                    5556**************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098547.7556434IPR005202Transcription factor GRAS
PfamPF035144.2E-8982469IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 471 aa     Download sequence    Send to blast
MEEIEAEQQE EEFLNLSLAI VDTDSGSGRK RKRKVRAVFD PLNSSHEGCE GKIFKLLQMR  60
EQMLKPDQKK KGVVEDGKGL HLIHLLLITA TAVDENNVAT ALENLSELYT SVCLTGDSVQ  120
RVVAYFADGL SARLLTRKSP FYEMIMKEPT SEEEFLAFTH LYRVSPYYQF AHFTANQAIL  180
EAFEKEEEEE SDSKSRILHV IDFDVSYGFQ WPSLIQSLSE KASSSNRISL RITGLGRSLE  240
ELQETESRLV SFAKGFRNLV FDFQGLLRGS KIISNPRIRK KNETVAVNLV SHLNTLNDFL  300
KIPDTLKSIH SLNPSIVILV EQEGSRSPRS FLSRFMESLH YFAAMYDSLD DCLPLESSER  360
LSIEKNHLGK EIKSMLNYDK DDLNCATRYE KMETWKGRME NHGFSGMKLS SKSLIQAKLL  420
LKIRTHHSPP QFNGENSSGS GFRVFERDEG KTISLGWQDR CLLTASAWRC V
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-37874698375GRAS family transcription factor containing p
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12833RKRKRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002526847.10.0PREDICTED: scarecrow-like protein 23
TrEMBLB9SLH80.0B9SLH8_RICCO; DELLA protein GAI1, putative
STRINGPOPTR_0013s11930.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF62002952
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54220.18e-50GRAS family protein